PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr026260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 360aa    MW: 39888.5 Da    PI: 6.5785
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr026260.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.8e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+ Ed +++ +v ++G g+W++++++ g++R++k+c++rw +yl
      Pbr026260.1 14 RGLWTAAEDAKILAYVSKHGVGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding483e-1568110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++T++E+e +++++k  G++ W+ Ia+ ++ gRt++++k++w++
      Pbr026260.1  68 DNFTPQEEEHIINLHKAIGSR-WSHIAKQLP-GRTDNDVKNYWNT 110
                      68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129426.22965IPR017930Myb domain
SuperFamilySSF466897.81E-3111108IPR009057Homeodomain-like
SMARTSM007171.7E-141363IPR001005SANT/Myb domain
PfamPF002493.8E-151461IPR001005SANT/Myb domain
CDDcd001671.38E-111761No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2465116IPR009057Homeodomain-like
SMARTSM007173.1E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129417.6666116IPR017930Myb domain
CDDcd001673.08E-1069112No hitNo description
PfamPF002491.6E-1369110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTAA EDAKILAYVS KHGVGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDNF TPQEEEHIIN LHKAIGSRWS HIAKQLPGRT DNDVKNYWNT KLKKKLSKMG  120
IDPVTHKPYS QILSDYGNIS GLPTAAGNQF SYFFKLSNRA FAPEPEPSSG ITGIPYTRVM  180
MNPNINGQGS EHNSCDSTLS LGFLAHRFQE SVQIEQPHFL NEITSSCSSS SSPRATDHQL  240
ISQPTYACRE SQEAQVTPSS SSFNWSEFLL QDPFASADPL KQEQDLHDVV MSSLENPKLG  300
VQGNSDAIEG CDFGGQRSNG LLDQQASSYS MSSFVETILD QDSEMQAAFP QLLDASFDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009335796.10.0PREDICTED: transcription factor MYB29
SwissprotQ9LSI72e-86MYB35_ARATH; Transcription factor MYB35
TrEMBLM5XBU21e-178M5XBU2_PRUPE; Uncharacterized protein
STRINGVIT_14s0066g02180.t011e-118(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-87MYB family protein